General Information

  • ID:  hor005947
  • Uniprot ID:  P11885
  • Protein name:  NPP
  • Gene name:  pomc
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QCWESNKCTDLSSEDGILECIKACKMDLSAESPVFPGNGHIQPLSENIRKYVMSHFRWNKFGRRNSTSNDNNNNNGGY
  • Length:  78
  • Propeptide:  MLQPVWHACILAILGVFIFHVGEVRSQCWESNKCTDLSSEDGILECIKACKMDLSAESPVFPGNGHIQPLSENIRKYVMSHFRWNKFGRRNSTSNDNNNNNGGYKREDIANYPILNLFLGSDNQNTQEGIMEDDALDRQDSKRSYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSESFPIELRRELSLEFDYPDTNSEEELDNGELLEGPVKKGRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
  • Signal peptide:  MLQPVWHACILAILGVFIFHVGEVRS
  • Modification:  T1 Pyrrolidone carboxylic acid;T61 Phenylalanine amide
  • Glycosylation:  T65 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11885-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005947_AF2.pdbhor005947_ESM.pdb

Physical Information

Mass: 1022937 Formula: C376H578N114O123S6
Absent amino acids: Common amino acids: N
pI: 7.29 Basic residues: 11
Polar residues: 34 Hydrophobic residues: 17
Hydrophobicity: -94.49 Boman Index: -20570
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 50
Instability Index: 9464.49 Extinction Coefficient cystines: 14230
Absorbance 280nm: 184.81

Literature

  • PubMed ID:  2788269
  • Title:  Nucleotide sequence of bullfrog pro-opiomelanocortin cDNA.
  • PubMed ID:  1331997
  • Title:  Purification and characterization of joining peptide and N-terminal peptide of proopiomelanocortin from the pars distalis of the bullfrog pituitary.